SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_2648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_2648
Domain Number 1 Region: 146-381
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.6e-65
Family D-glucarate dehydratase-like 0.0000366
Further Details:      
 
Domain Number 2 Region: 20-147
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.55e-34
Family Enolase N-terminal domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_2648
Sequence length 383
Comment (Saccharophagus degradans 2-40)
Sequence
MSKCLMESIVELELPQGNPIKIKSVAVEHYKVPLAEVLSDAKHGDHTYFELIVSRITCQN
GVEGVGYTYTGGSGGSAIYSLLVDEIKPMLVGRDATQILAIWEEIYWRLHYVGRGGLVSF
AQSAVDIALWDIRCKLLGQPLWKVAGGLSNKTRCYAGGIDLNFSQEKLLSNIQGYLDAGF
NAVKIKVGKDNIKEDIARVRAVRELIGKDTTFMVDANYSMTKEKAIRFANAIEDQNITWF
EEPTLPDDYQGYADIAQAISIPLAMGENLHTIHEFTYAVQQAKLGFLQPDASNIGGITGW
LNVASLANAHNLPVCSHGMQELHVSLMSSQPNAGYLEVHSFPIDQYTTQPLAMENGYALA
PDIEGTGVVFVDELLRGHLAKKS
Download sequence
Identical sequences Q21HC1
203122.Sde_2648 gi|90022293|ref|YP_528120.1| NYSGXRC-9483a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]