SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_0580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_0580
Domain Number 1 Region: 14-162
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.26e-42
Family Pentapeptide repeats 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_0580
Sequence length 194
Comment (Trichodesmium erythraeum IMS101)
Sequence
MEVERLLERYAAGERNFRDTDLFRANLNNVSLAGVNLFRANLFRANLFRANLIGINLYNS
TLIGANLYGANLSGANLSGANLTRANLTGADLSGADLSAADLSGAILSYAHLSYADMSRT
NLHKATLIGTNLSGANLSGADLRDIKITKVNVTETKFALAIGLSKDMKLELHQQGARVED
MPKELYASKLLSRI
Download sequence
Identical sequences Q118P9
gi|113474437|ref|YP_720498.1| WP_011610419.1.43450 203124.Tery_0580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]