SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_0704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_0704
Domain Number 1 Region: 38-158
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00000824
Family HEPN domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_0704
Sequence length 174
Comment (Trichodesmium erythraeum IMS101)
Sequence
MKDSSIKESKESKESKDSKDSKDSSIKESFKSHFKESFIQAAGRHLYDAEIMLAQHRWDN
AVYLAGYVVECTLKVIVEQYINNKACQKFGHNLRQLQGKGIGRLRIIYPILDAQLSISRI
KGTVLAEYHPERRYFQSGWCKEFKAKEAVKRAAEIYNEIIPKLILDGRISSEEL
Download sequence
Identical sequences Q118D6
WP_011610531.1.43450 gi|113474550|ref|YP_720611.1| 203124.Tery_0704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]