SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_1057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_1057
Domain Number 1 Region: 442-533
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000186
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_1057
Sequence length 574
Comment (Trichodesmium erythraeum IMS101)
Sequence
MATQVFNKIHFRNLQGDIFGGLTAAVIALPMALAFGVASGAGPAAGLYGSVLVGLFAALF
GGTPTLISEPTGPMTVVMTAVIANLTATNPENGMTMAFTVVMLAGLFQISFGFLKLGKYI
TMMPYNVISGFMSGIGLILIILQIGPFLGQASPKGGVIATIENLPQLLNNINPIETGLAV
LTVVILFSMPTKLKKIFPAPLVALVIGTIISIVFFSDIDIRRIGEIPSGLPSLQLPYFTA
GQLQLMVVDAIVLAMLGCIDALLTSVVADSLTRTQHDSDKELIGQGLGNLASGLFGGIPG
AGATMGTVVNINTGARTALSSITRAVILMVVVLGAASLTAQIPMAVLAGIAFQVGIKIID
WGFLKRAHRISWKSAIIMYAVIGLTVFVDLITAVGIGVFIANVLTIDRLTQLKSEDVKAI
TDADDAIILDNDEKELLDRAEGRILLFHLSGPMIFGISKAISRQHTHLNNYEVLIVDLSE
VPHMGVTSALAIENVIQETIDTGRNVFLVGAAGSVKLRLEKLGVLNIVPSENMLMDRKQA
LVKAVALVTSDVNINDPIQNGAKGIQSGIDNIIK
Download sequence
Identical sequences Q116Z6
203124.Tery_1057 gi|113474840|ref|YP_720901.1| WP_011610814.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]