SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_1058 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_1058
Domain Number 1 Region: 436-526
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000165
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_1058
Sequence length 550
Comment (Trichodesmium erythraeum IMS101)
Sequence
MQLVNSLHFNNLRGDLLGGLTAAIVALPLALAFGVSSGAGAITGLYGAIFVGFFAALCGG
TPSQITGPTGPMTVLMATVFTTLLADNPDAGLEMAFTVVMLGGIFQILFGVLQLGKYIVL
IPYAVISGFMSGVGVIIIIIQIGPFLGHPASASVAQSIKKIPEFLINLNPAAVGLGILTI
VILLFTPRKVTAIIPSPLLALLTGTLISVFFLSDSNLILIGEIPTGLPKLHLPVFTFNQL
QNMLVDGLVLGTLGSIDSLLTSLVADNITRSNHDSDHELIGQGIGNIMSGLFGGLPGAGA
TMRTVVNVHAGGKTPLSGIVHSIILLLILLWAGKLTEAIPQAILAGILLKVGVDIIDWGF
LKRAHNLSLKAAGIMYSVLILTVFVNLVTAVAVGIFIANLLTVKRLSDMQINDIKAIVEP
NDEIPLRDQEKQLLKECRGHLLLLHLGGPMSFGAAKALSRHMGMVQQYDVLILDLSDVSY
LGITMSLALENMVTEASRKHREVFIVGASGGVKTRLGKLKIWNFVPRQNLVGTRIKALQQ
TLNLLVERKI
Download sequence
Identical sequences Q116Z5
gi|113474841|ref|YP_720902.1| 203124.Tery_1058 WP_011610815.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]