SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_1951 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203124.Tery_1951
Domain Number - Region: 89-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00209
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_1951
Sequence length 154
Comment (Trichodesmium erythraeum IMS101)
Sequence
MLLNPTIFWLLAGATLCFLEFFVPTAFVEFMMGLSAFVVALVSLLIPSVSLQVALWMIFS
VASIFAFRYLLPHRKIAIIADSKEGETLTEILPGQPGRVLYEGNSWRAKCDDQDIMIPAQ
EKVIVLRREGNTLFILPENLLNSSVYLPNQNQLK
Download sequence
Identical sequences Q113X0
203124.Tery_1951 gi|113475616|ref|YP_721677.1| WP_011611577.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]