SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_2311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_2311
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_2311
Sequence length 80
Comment (Trichodesmium erythraeum IMS101)
Sequence
MDLSKIDFVDSSGLGALVQLVKHTKDKEGTLQIVSNARVKQTVKLVRLEKFLSLRSTLEE
AIEDIKNSHPNKAKTDDQDR
Download sequence
Identical sequences Q112N9
203124.Tery_2311 gi|113475947|ref|YP_722008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]