SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203907.Bfl540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203907.Bfl540
Domain Number 1 Region: 8-162
Classification Level Classification E-value
Superfamily RNase III domain-like 8.37e-46
Family RNase III catalytic domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 112-226
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.04e-28
Family Double-stranded RNA-binding domain (dsRBD) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203907.Bfl540
Sequence length 232
Comment (Candidatus Blochmannia floridanus)
Sequence
MQCIKCIEINLLQKKLGYFFHTVDLLLRALTHRSFSNKHNERLEFLGDSILNYSITNILY
HRYNHMDEGDMSRIRSSLVCSRTLVELAKEFKLGNCLKLGQGELKNKGYNRESILADTVE
AIIGGIFLDSNIKTIEMLIAFWYQFRLNKIDLEDKQKDPKTRLQEYLQHHHLPLPIYCIN
QVQGQAHDQIFIMNCQVSSLKYSVMGRGSSRRKAEQDAAENALKFLIEINND
Download sequence
Identical sequences Q7VRR0
203907.Bfl540 gi|33519987|ref|NP_878819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]