SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204536.SULAZ_0433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204536.SULAZ_0433
Domain Number 1 Region: 19-181
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.96e-27
Family Biotin dependent carboxylase carboxyltransferase domain 0.087
Further Details:      
 
Domain Number 2 Region: 353-420
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000288
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204536.SULAZ_0433
Sequence length 422
Comment (Sulfurihydrogenibium azorense Az Fu1)
Sequence
MKKFLVLLLLFIFKFSFAEVFVGKWNDAITPTTVDYVKRLVEKAERENGKAVILMLDTPG
GLDTSMREIIKIIQNTSIPFVVFVYPPGSRAASAGAIITVSADIAAMAPSTNIGSASPVS
MEGRDIEETMKKKVVNDMVAFVSAIAKEKGRNSEIIQKMITESVNLPSDEAVNKKVVDLV
AKDLNDLIDKINGKKIVKNNREIILNLKGDKIVFVEKSFKEELLSFLSNPTVAYFLLMIG
FYGIFFELYNPGSIIPGTVGLISLALALYSLNILSVNWLGVVLIGLGILFFILEAITPLF
GGLALAGTISILLGSIILLPSDSPYGDLSLSVIIPVVLFSAVFFFIVSYLSLKVHKEKPK
TGIEAMVGDIAEVVSDIDKKGGKVMYHGELWNAYSDKFIPAGSKVKIVEVNGLKLKVEEV
KE
Download sequence
Identical sequences C1DTI8
204536.SULAZ_0433 WP_012673623.1.69036 gi|225848262|ref|YP_002728425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]