SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 204536.SULAZ_0490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204536.SULAZ_0490
Domain Number 1 Region: 10-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 4.32e-28
Family Family 1 bi-partite nucleotidyltransferase subunit 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204536.SULAZ_0490
Sequence length 140
Comment (Sulfurihydrogenibium azorense Az Fu1)
Sequence
MEKFARSFERFKKAYRKFEEVVNNPFLPDIFKDEFLIEITTKRFEYTYEALWKTIKEFLR
LRGLECNSPKSCFKEAFKEGLITTEYEEVIFDMIVLRNNLVHVYDEEMAKEIYSKIEQDK
FLKAFKTIINKIEEIIQNGV
Download sequence
Identical sequences C1DTP5
WP_012675004.1.69036 gi|225848319|ref|YP_002728482.1| 204536.SULAZ_0490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]