SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_0673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  204669.Acid345_0673
Domain Number - Region: 9-122
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000106
Family Sfri0576-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_0673
Sequence length 131
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MPVTYEIDAARKLVRTRCVGPVRMMDVLDHFRTLEADPACPPHADVFLDLVELQSLPKSF
QLAGVVYEVEQLQPKVRFGACAIVVDREVLFGMMRIFATLAEGTFRVVRVFRKREEAEQW
LQGEQSASTAR
Download sequence
Identical sequences Q1ITX2
gi|94967704|ref|YP_589752.1| 204669.Acid345_0673 WP_011521480.1.86553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]