SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_2415 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_2415
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000118
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_2415
Sequence length 142
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MERIPILRMGEFLLVTIQVDMHDRLAMQLQDDLTNKIVQHSARGVLIDISALEIVDSFIG
RMLGNIAAMSRVLDAATVVVGMQPAVAITLVELGLSLPGVRAALNVERGMELIRREVREM
SGEGDEDEHDSEEDEVDAEAGE
Download sequence
Identical sequences Q1INY4
WP_011523217.1.86553 gi|94969442|ref|YP_591490.1| 204669.Acid345_2415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]