SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_2529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_2529
Domain Number 1 Region: 17-187
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.23e-28
Family Clp protease, ClpP subunit 0.059
Further Details:      
 
Domain Number 2 Region: 359-425
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000759
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_2529
Sequence length 438
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MRRLLLLFAALCIALPSLAQVVRLKLDDTIQPVSEEYISRGIDYAAEHNAQAVLIELHTP
GGLVTSTRAIISKILGSKVPVIIYVYPTGANAASAGFFILESADIAAMAPGTNTGSAHPV
SLAFGVAQTKEDDTMKAKIENDLAAFLRSYVSKRGRNVALAETGVRESKAFSDQEALSQN
LIDVIAKDEQDLLSQVNGRTVKRFDGSTVVMKIAAAPITDYDRSLKERLLGFLVDPNIAF
LIFAIGAIGLYAEFNHPGAIIPGVVGTVCILLALFAFHFLPIRYAAVTLILASFIFFALE
AKFATHGILGIAGIACLALGGMLLVDGPIPEMRVKWEMALSVSVAFGLITVFLMTIALRA
RRNKVTTGIQGLLGQTGVARSPLSPTGKVTVMGEIWDAASLVPVAAGEPVVIRGIDGLTL
RVEPVAQSVAAREVVLQR
Download sequence
Identical sequences Q1INM0
WP_011523331.1.86553 204669.Acid345_2529 gi|94969556|ref|YP_591604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]