SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_2743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_2743
Domain Number 1 Region: 19-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_2743
Sequence length 116
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MADKAATSSFIVVVNRDAAVPVVRCTGRLVLGLTDELLLPVKQLISASKRIVLDFTELTR
MDSSGLGTIVRLLVTAKAAGCSLELKNVGPPIRQLLGITNLLDAFTIIGENNIKLG
Download sequence
Identical sequences Q1IN06
204669.Acid345_2743 WP_011523545.1.86553 gi|94969770|ref|YP_591818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]