SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204669.Acid345_2888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204669.Acid345_2888
Domain Number 1 Region: 110-257
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.33e-31
Family Potassium channel NAD-binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 5-134
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-16
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Domain Number 3 Region: 257-341
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.000000000288
Family TrkA C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 204669.Acid345_2888
Sequence length 357
Comment (Candidatus Koribacter versatilis Ellin345)
Sequence
MRLSKRLGTPVLLLVAIITASVVGYRLLGGPDVHILDAIYMAIITLAGVGYGEIIDTTHN
PALRIFNIGVIMVGVTFTVYVFSAVTAFLVEGQLTDLFRKRKMQKRLSELKNHYIVCGLG
DTGRYVVGELQKTGTPFVVIDQNEEHIKNFIEKGGDAYHDMLYVTGDATDELLLDQARLD
VAKGLIAAVAADKDNLVITVLARQKSQKVRIVARWTDQRYSDRLLKSGANATVSPNAIGG
MRMASEVLRPHVVGFLDMMLREQSKTLRIEEVVIKGHSPWAGKSLESLQLKALYNLLPLA
IRSHGDGKTPNFWVNPPDNVLLASDSVVIVMGDVNDIRRARTDSQEDLEPAAAPATV
Download sequence
Identical sequences Q1IML1
gi|94969915|ref|YP_591963.1| WP_011523690.1.86553 204669.Acid345_2888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]