SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204722.BR1386 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204722.BR1386
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.2e-27
Family Sfri0576-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 204722.BR1386
Sequence length 133
Comment (Brucella suis 1330)
Sequence
MMRNESIPVIRRIPTSRDDVFAFAIEGHLDDASLENLYGLLDAAYETHEKIDLLIRLTGY
EGVDWVSAFSESMLSIRSKSLKHLRRYAIIGGPLWIQASITLVQPFLSIEVRAFDPDEEQ
DAWEWLDAKPVEE
Download sequence
Identical sequences A0A0H3G4E7 A0A1Z1ZM41 A0A2D2BQ45 A9M643 B0CHH3 C0RE26 C7LCX8 D0RJT0 D6LNF9
gi|225852869|ref|YP_002733102.1| WP_004686378.1.100018 WP_004686378.1.100204 WP_004686378.1.100628 WP_004686378.1.100807 WP_004686378.1.101150 WP_004686378.1.101247 WP_004686378.1.101411 WP_004686378.1.102026 WP_004686378.1.10307 WP_004686378.1.1055 WP_004686378.1.10844 WP_004686378.1.10866 WP_004686378.1.11066 WP_004686378.1.1158 WP_004686378.1.11769 WP_004686378.1.11859 WP_004686378.1.11933 WP_004686378.1.12704 WP_004686378.1.12925 WP_004686378.1.12981 WP_004686378.1.13020 WP_004686378.1.1327 WP_004686378.1.13576 WP_004686378.1.13592 WP_004686378.1.14323 WP_004686378.1.14507 WP_004686378.1.15325 WP_004686378.1.16733 WP_004686378.1.17733 WP_004686378.1.1800 WP_004686378.1.18494 WP_004686378.1.19182 WP_004686378.1.19483 WP_004686378.1.19645 WP_004686378.1.20827 WP_004686378.1.2214 WP_004686378.1.22142 WP_004686378.1.22340 WP_004686378.1.23391 WP_004686378.1.23458 WP_004686378.1.24496 WP_004686378.1.24607 WP_004686378.1.2483 WP_004686378.1.24895 WP_004686378.1.24923 WP_004686378.1.24971 WP_004686378.1.25135 WP_004686378.1.25450 WP_004686378.1.25561 WP_004686378.1.27052 WP_004686378.1.27794 WP_004686378.1.29765 WP_004686378.1.29997 WP_004686378.1.31463 WP_004686378.1.31635 WP_004686378.1.31644 WP_004686378.1.31680 WP_004686378.1.32779 WP_004686378.1.33032 WP_004686378.1.33289 WP_004686378.1.33466 WP_004686378.1.3390 WP_004686378.1.33907 WP_004686378.1.34183 WP_004686378.1.34225 WP_004686378.1.34423 WP_004686378.1.35338 WP_004686378.1.35577 WP_004686378.1.36149 WP_004686378.1.36712 WP_004686378.1.3681 WP_004686378.1.38343 WP_004686378.1.38790 WP_004686378.1.38925 WP_004686378.1.40138 WP_004686378.1.40189 WP_004686378.1.408 WP_004686378.1.4091 WP_004686378.1.41105 WP_004686378.1.41344 WP_004686378.1.41893 WP_004686378.1.41941 WP_004686378.1.41950 WP_004686378.1.42065 WP_004686378.1.4207 WP_004686378.1.42071 WP_004686378.1.42633 WP_004686378.1.42774 WP_004686378.1.4295 WP_004686378.1.43006 WP_004686378.1.43058 WP_004686378.1.43148 WP_004686378.1.4319 WP_004686378.1.43359 WP_004686378.1.43583 WP_004686378.1.43689 WP_004686378.1.43928 WP_004686378.1.44045 WP_004686378.1.44060 WP_004686378.1.44294 WP_004686378.1.44541 WP_004686378.1.44793 WP_004686378.1.44989 WP_004686378.1.45546 WP_004686378.1.47516 WP_004686378.1.47545 WP_004686378.1.47843 WP_004686378.1.48075 WP_004686378.1.48184 WP_004686378.1.48396 WP_004686378.1.48727 WP_004686378.1.48948 WP_004686378.1.49089 WP_004686378.1.49427 WP_004686378.1.49542 WP_004686378.1.49753 WP_004686378.1.49942 WP_004686378.1.50924 WP_004686378.1.50952 WP_004686378.1.51553 WP_004686378.1.52027 WP_004686378.1.52478 WP_004686378.1.52541 WP_004686378.1.5307 WP_004686378.1.53843 WP_004686378.1.54481 WP_004686378.1.55047 WP_004686378.1.55284 WP_004686378.1.55585 WP_004686378.1.5609 WP_004686378.1.56313 WP_004686378.1.56621 WP_004686378.1.56687 WP_004686378.1.56947 WP_004686378.1.57541 WP_004686378.1.57564 WP_004686378.1.58260 WP_004686378.1.58868 WP_004686378.1.59091 WP_004686378.1.5971 WP_004686378.1.59985 WP_004686378.1.60134 WP_004686378.1.60631 WP_004686378.1.60920 WP_004686378.1.61081 WP_004686378.1.61543 WP_004686378.1.61961 WP_004686378.1.62592 WP_004686378.1.62872 WP_004686378.1.62990 WP_004686378.1.62997 WP_004686378.1.63628 WP_004686378.1.63732 WP_004686378.1.6440 WP_004686378.1.64585 WP_004686378.1.64849 WP_004686378.1.65199 WP_004686378.1.65299 WP_004686378.1.65501 WP_004686378.1.65597 WP_004686378.1.65651 WP_004686378.1.66078 WP_004686378.1.66268 WP_004686378.1.66340 WP_004686378.1.66407 WP_004686378.1.66647 WP_004686378.1.66855 WP_004686378.1.67107 WP_004686378.1.67402 WP_004686378.1.67659 WP_004686378.1.68488 WP_004686378.1.6942 WP_004686378.1.69522 WP_004686378.1.69997 WP_004686378.1.70160 WP_004686378.1.70296 WP_004686378.1.70570 WP_004686378.1.70760 WP_004686378.1.71002 WP_004686378.1.71228 WP_004686378.1.72189 WP_004686378.1.72439 WP_004686378.1.72533 WP_004686378.1.73628 WP_004686378.1.73739 WP_004686378.1.7388 WP_004686378.1.74005 WP_004686378.1.74236 WP_004686378.1.75128 WP_004686378.1.75563 WP_004686378.1.75678 WP_004686378.1.7667 WP_004686378.1.76877 WP_004686378.1.77165 WP_004686378.1.77281 WP_004686378.1.77683 WP_004686378.1.77685 WP_004686378.1.78225 WP_004686378.1.78590 WP_004686378.1.78716 WP_004686378.1.79327 WP_004686378.1.79993 WP_004686378.1.80059 WP_004686378.1.8012 WP_004686378.1.80167 WP_004686378.1.80365 WP_004686378.1.81027 WP_004686378.1.81276 WP_004686378.1.81377 WP_004686378.1.81558 WP_004686378.1.81674 WP_004686378.1.82205 WP_004686378.1.8223 WP_004686378.1.82390 WP_004686378.1.82448 WP_004686378.1.82565 WP_004686378.1.82595 WP_004686378.1.82753 WP_004686378.1.82834 WP_004686378.1.82990 WP_004686378.1.83161 WP_004686378.1.84207 WP_004686378.1.84512 WP_004686378.1.84540 WP_004686378.1.84601 WP_004686378.1.84764 WP_004686378.1.85684 WP_004686378.1.85721 WP_004686378.1.85753 WP_004686378.1.86832 WP_004686378.1.86901 WP_004686378.1.86923 WP_004686378.1.87222 WP_004686378.1.87893 WP_004686378.1.88404 WP_004686378.1.88424 WP_004686378.1.88658 WP_004686378.1.88867 WP_004686378.1.89113 WP_004686378.1.90027 WP_004686378.1.90420 WP_004686378.1.9096 WP_004686378.1.91081 WP_004686378.1.9163 WP_004686378.1.91768 WP_004686378.1.91958 WP_004686378.1.92383 WP_004686378.1.9303 WP_004686378.1.93230 WP_004686378.1.93367 WP_004686378.1.94513 WP_004686378.1.94648 WP_004686378.1.94770 WP_004686378.1.95141 WP_004686378.1.95148 WP_004686378.1.95178 WP_004686378.1.95770 WP_004686378.1.96661 WP_004686378.1.96710 WP_004686378.1.97240 WP_004686378.1.97320 WP_004686378.1.97331 WP_004686378.1.97860 WP_004686378.1.98362 WP_004686378.1.98704 WP_004686378.1.98764 gi|23502257|ref|NP_698384.1| 204722.BR1386 470137.BSUIS_A1436 483179.BCAN_A1417 546272.BMEA_A1433 568815.BMI_I1396 gi|161619332|ref|YP_001593219.1| gi|256369801|ref|YP_003107312.1| gi|376281049|ref|YP_005155055.1| gi|163843640|ref|YP_001628044.1| gi|340790995|ref|YP_004756460.1| gi|23502257|ref|NP_698384.1| gi|384445427|ref|YP_005604146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]