SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 204773.HEAR0978 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  204773.HEAR0978
Domain Number 1 Region: 452-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 204773.HEAR0978
Sequence length 565
Comment (Herminiimonas arsenicoxydans)
Sequence
MKPFRFSFRPSLLKDLRGYDVPAFFRDLSAGLTVGIVALPLAMAFAIASGVKPEAGIFTA
IIGGFLISALGGSRIQIGGPAGAFIVIIYGIVEKYGVANLLIATIFAGLMLCAMGFFRLG
SLIRYIPVPIVIGFTNGIAVLIALSQMKDFFGLHIEKMPGDFFAQIQTLTANAHSFNLAS
IAIALVSLLLIFIWPKLWQAKPNTMDEVIGGKDKRILRILRAFPGTILVLVLATLAVSLF
DLQVDTIGSKFGGIPQGLPSFALPHFTWELVKQLFPPALTIALLGAIESLLCARVADNIT
GDRHDPNQELMAQGCANFIVPFFGGIPATGTIARTVTNIRAGAVSPIAGILHALTLLVIV
LVAAPLASNIPLAALAAILLYVAYNMGEWHEFARLRHFSMNYRILMLATFLLTVIVDLTV
AVQVGLVLACVFFIYRISSLTRIELIPPDRLSTPLPHGVLAYSIFGSLFFGAVDKLEGLI
EAESMPEQALILELHQLINLDATGLDALETVRKTLQKKGSQLILCGPNRQPLDLMRRSGF
LARLGPQNCLDNLPDALARSAALAA
Download sequence
Identical sequences A4G3S4
gi|134094213|ref|YP_001099288.1| WP_011870499.1.36655 204773.HEAR0978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]