SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205913.BLD_1457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205913.BLD_1457
Domain Number 1 Region: 8-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-39
Family Voltage-gated potassium channels 0.00025
Further Details:      
 
Weak hits

Sequence:  205913.BLD_1457
Domain Number - Region: 205-253
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0732
Family PspA lactotransferrin-binding region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205913.BLD_1457
Sequence length 255
Comment (Bifidobacterium longum DJO10A)
Sequence
MGLKTWKKWTDWPLMVLSVVFLVVYSWEILSRTHIALCETVINVIWVVFVVDYVVSLWLA
DDRWRWFKHNLFALLTIALPMLRPLRLLRLLTVLHVLNRTSGMAVRGRITVYAVGAVGML
MYVGALAVYSVERGASGSTITDFGTALWWAFVTVTTVGYGDFSPVTFQGKIIAVVLMFTG
IALIGIVTATLASWIVDQVNLETDRREDAREKEVAKEAAQEAIATSANPEIDLLREEVRE
LTATVAGLRTELERR
Download sequence
Identical sequences B3DP43
205913.BLD_1457 WP_010081212.1.22978 WP_010081212.1.89707 gi|189440319|ref|YP_001955400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]