SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205914.HS_0572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  205914.HS_0572
Domain Number - Region: 89-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000209
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205914.HS_0572
Sequence length 147
Comment (Haemophilus somnus 129PT)
Sequence
MEWFDAWTFWHWLILGFLLLIAEIIVPGVFLLWWGLAAIIVSMITIIIDLSLTIQCVIYG
ILAIVLSVAWWKYQHTKDEKDQANSSLNRRDHAMLGCRGKVEVIAENGIGRGVFGDTTWR
IQGKGLQQGDIIEVQAVNGITLIVQKK
Download sequence
Identical sequences Q0I1X9
205914.HS_0572 WP_011608730.1.4738 WP_011608730.1.80932 gi|113460717|ref|YP_718784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]