SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_1363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_1363
Domain Number 1 Region: 144-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-130
Family Enolase 0.00000000357
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-55
Family Enolase N-terminal domain-like 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_1363
Sequence length 428
Comment (Pseudomonas syringae pv B728a)
Sequence
MAKIVDIKGREVLDSRGNPTVEADVLLDNGIIGSACAPSGASTGSREALELRDGDKSRYM
GKGVLKAVANINGPIRDLLLGKDPVDQKALDHAMIELDGTENKASLGANAILAVSLAAAK
AAAQDQDLPLYAHIANLNGTPGVYSMPVPMMNIINGGEHADNNIDIQEFMIQPVGAKSFA
EGLRWGTEIFHHLKAVLKARGLNTAVGDEGGFAPNLASNKEALDAIAEAVANAGYTLGTD
VTLALDCAASEFYKNGKYKLSEEGEYSSAEFAEYLAELTRKHPIISIEDGLDESDWDGWK
ILTDKIGEKTQLVGDDLFVTNTKILKEGIDKKIANSILIKFNQIGTLTETLEAIQMAKAA
GYTAIISHRSGETEDSTIADLAVGTSAGQIKTGSLCRSDRVSKYNQLLRIEEQLGSKAVY
RGRAEFRG
Download sequence
Identical sequences A0A0F6XB19 A0A0N8Q903 A0A0P9Z0H7 A0A0Q0CE01 A0A0W0LYU9 A0A2G0VPD9 A0A2G4EIV4 F3G1K5 Q4ZWQ8 S3MCF7
WP_003339565.1.11701 WP_003339565.1.131 WP_003339565.1.15686 WP_003339565.1.15807 WP_003339565.1.19020 WP_003339565.1.19481 WP_003339565.1.20366 WP_003339565.1.20537 WP_003339565.1.21 WP_003339565.1.24052 WP_003339565.1.28593 WP_003339565.1.30731 WP_003339565.1.31208 WP_003339565.1.34709 WP_003339565.1.36192 WP_003339565.1.4636 WP_003339565.1.46407 WP_003339565.1.47305 WP_003339565.1.47642 WP_003339565.1.48757 WP_003339565.1.48899 WP_003339565.1.49784 WP_003339565.1.53502 WP_003339565.1.54407 WP_003339565.1.54758 WP_003339565.1.56854 WP_003339565.1.58699 WP_003339565.1.59889 WP_003339565.1.66749 WP_003339565.1.67351 WP_003339565.1.7215 WP_003339565.1.7222 WP_003339565.1.72581 WP_003339565.1.73557 WP_003339565.1.78224 WP_003339565.1.80483 WP_003339565.1.80590 WP_003339565.1.81429 WP_003339565.1.81892 WP_003339565.1.85119 WP_003339565.1.86070 WP_003339565.1.87476 WP_003339565.1.88593 WP_003339565.1.91016 WP_003339565.1.92003 WP_003339565.1.98823 YP_234452.1.68675 205918.Psyr_1363 gi|66044611|ref|YP_234452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]