SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_3021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_3021
Domain Number 1 Region: 716-960
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.68e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 2 Region: 48-229
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-19
Family Pyruvate oxidase and decarboxylase Pyr module 0.061
Further Details:      
 
Domain Number 3 Region: 432-618
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000109
Family PFOR PP module 0.035
Further Details:      
 
Domain Number 4 Region: 265-395
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000392
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_3021
Sequence length 1160
Comment (Pseudomonas syringae pv B728a)
Sequence
MSLADIRLDDKYRLATGNLYLTGTQALTRLPMLQKQRDEAQGLNTAGFISGYRGSPLGNL
DKSLWDAKDYLRQNAIHFQPGINEELAATAVWGSQQVNLFPHGKYDGVFALWYGKGPGVD
RCGDVFKHGNSAGVAANGGVLILAGDDHGCKSSTIAHQSEHAFIASMIPVLNPSNVQEIL
DYGIIGWELSRYSGCWVAMKTIAENVDSSAVVEVDPLRIKTRIPDDFDLPEGGLHIRWPD
PPLAQEARLNTYKIYAARAFARANQLNKVVIDSAQPRLGIITTGKSYLDVRQALEELGID
QELCEKVGIRVLKVGMSWPLEPVSVHDFAEGLDEILVVEEKRSVIEDQLTGQLYNWPVER
RPVVVGEFDEQGRSLLPNLSELTPAMIARVIAKRLAPFYSSPQIEARLQFLSDKEQALQA
PLFNTQRTPHFCSGCPHNTSTKVPEGSRALAGIGCHYMTIWMDRETDTFTQMGGEGVTWI
GQAPFTETPHVFQNLGDGTYFHSGHLALRAAVASKVNITYKILYNDAVAMTGGQPIDGVL
RVDQLSRQVFNEGVLRIALVSDEPDKYPSREDFAPITTFHHRRDLDSVQRELREFKGVSV
IIYDQTCATEKRRRRKRGTMPNLEKRALINPAVCEGCGDCGVKSGCLSVLPKETAQGRKR
EIDQSACNKDFSCVEGFCPSFVTVHGGKLRKPALPKQVEAFARLPEPVLPSLDRPFNILL
PGVGGTGVTTVGAMLGYAANLEGKGCSVLDQAGLAQKFGPVVSHIRIAARQEDLFAVRIA
AGEAHLLLGCDLLVAAGPDAIAKLDSKISHAVVNSQQTPTAEFTRNPDAVFPAEAMKQTI
IEAVGAAKTHFVEATSLATRLMGDSIASNLFMLGYAFQLGLIPLTSAAIEKAIELNGVAV
NLNQQAFLWGRRTAHDPAAVEAFVNPQDKVSEPQSVDLDQRIQSNVDALKQYQNAAYAKR
YLALVQRVRDSESRAFPGQQPTLTEAVAFNYFKLLAYKDEYEVARLYSNGEFTRQLQAQF
EGDYRLEFHLAPSWLAKRDPHNGLPRKRSFGPWMLRAFDVLARFKFLRGTALDPFGRSLE
RQQERALIDRYVSDVELILQHLQAQNRHTALSLARLPERIRGYGYIKESAMKAAAVQADI
LRKSLESGEVAAPKLYEAAA
Download sequence
Identical sequences Q4ZS17
205918.Psyr_3021 YP_236093.1.68675 gi|66046252|ref|YP_236093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]