SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_3120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_3120
Domain Number 1 Region: 144-420
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.62e-85
Family D-glucarate dehydratase-like 0.000000000285
Further Details:      
 
Domain Number 2 Region: 13-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-33
Family Enolase N-terminal domain-like 0.000000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_3120
Sequence length 450
Comment (Pseudomonas syringae pv B728a)
Sequence
MNIQQSNITSKAPVITEMQVVPVAGHDDMLLNLSGAHGPYFTRNVVILKDNAGHVGVGEV
PGGELIRQTLEDARSLVVGSSIGTYQKILNQARKAFADRDSGGRGLQTFDLRIAIHAVTA
LEAALLDLLGQHLEVPVAALLGEGQQRDQVEMLGYLFYVGDQRKTDLAYRSEPEADNDWF
RIRHEEALTPEAVVRLAEAAHQRYGFQDFKLKGGVLSGDQEIEAVTALAERFPDARITLD
PNGAWSLKEAIRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLKTATNMIATDW
REMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVA
AAAPGTITAIDTHWIWQDGQRLTKAPLQIVGGKVEVPNKPGLGVELDMDQLAKAHELYKG
MGLGARNDAVAMQFLIPDWTFNNKQPCLVR
Download sequence
Identical sequences Q4ZRS0
WP_011268234.1.11701 WP_011268234.1.34709 YP_236190.1.68675 gi|66046349|ref|YP_236190.1| 205918.Psyr_3120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]