SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205918.Psyr_3452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205918.Psyr_3452
Domain Number 1 Region: 8-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.75e-20
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205918.Psyr_3452
Sequence length 115
Comment (Pseudomonas syringae pv B728a)
Sequence
MTVTSERSADGQTLTLYIEGRFDFNSHQAFRTAYEDYPQSLNYVVDLRGTHYLDSSALGM
LLLLRDHAGGDKALVRLVNCTPDVLKILAISNFSKLFELSIPSAASPEQTVHSDR
Download sequence
Identical sequences A0A0Q0C7Y0 A0A120ALD0 A0A2G0VFK5 Q4ZQT8
gi|66046681|ref|YP_236522.1| WP_004408073.1.11701 WP_004408073.1.19481 WP_004408073.1.19682 WP_004408073.1.2893 WP_004408073.1.31208 WP_004408073.1.34709 WP_004408073.1.36917 WP_004408073.1.48757 WP_004408073.1.49784 WP_004408073.1.53502 WP_004408073.1.58699 WP_004408073.1.7215 WP_004408073.1.72581 WP_004408073.1.73557 WP_004408073.1.81892 WP_004408073.1.86070 WP_004408073.1.92003 YP_236522.1.68675 205918.Psyr_3452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]