SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205920.ECH_1093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  205920.ECH_1093
Domain Number - Region: 179-257
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0022
Family Voltage-gated potassium channels 0.0089
Further Details:      
 
Domain Number - Region: 299-362
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 0.00445
Family Purine and uridine phosphorylases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205920.ECH_1093
Sequence length 486
Comment (Ehrlichia chaffeensis Arkansas)
Sequence
MYKSLRSIIFIIGVFCLIFSLLMFIPVAVDYCTGYIWQNFFCACLFTLFFSLICISIGRL
SNLKKTEVFIVTTVVWIVLSVIAAVPFVFEDKIAYIDAFFESVSGLTTTGATILTNLQNQ
SPGILIWRSLLNAIGGLGIIVSGIFLLPCLKVVSLHELYRSESSDQSRKFKYGIVRSSMY
IFAIYCLLIILCSMLYWIAGMSWFDAICHAMSTVSTGGFSNYDDSLQHFNNVYIEVIAII
FMLLSSCPLILYVKVITKQCFYDEQVIFFGIILFLFIIISAINCYFDEITAGYSLPNVLR
YSAFSVVSLSTSTGFINYDYSNWHFFSVFGVFIMLIGGCSGSTNSGIKVYRIMLLLKAFN
AYISDLLHHSRTSTIRYNRRYVSKNFIGDIGLFFFLYVFVLFIGCILISSSGVNFITAFS
TVAAAFSNTGPGMGDIVGPSANYYHMLPLVKVFLSCLMLMGRLEIIPFFACAYLIVNGLF
DSKSKC
Download sequence
Identical sequences Q2GFA5
205920.ECH_1093 gi|88657815|ref|YP_507878.1| WP_011452996.1.16389 WP_011452996.1.20904 WP_011452996.1.31359 WP_011452996.1.56909 WP_011452996.1.68154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]