SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_0167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_0167
Domain Number 1 Region: 100-166
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000183
Family NfeD domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_0167
Sequence length 175
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MNIRCCALALLLLSGSVIAADNPFTAASPVGLWLITLGITFLIAEAALPNYGVIGLGGIV
MFVIGALILSNAELPVPMMIGLGLVSALLLIALLIRALKTRPRHPVSGDAGLLGSVTAVT
VVQLEDSRNGWVQLQGERWQVLSATPLHTGQPVRVVGRKGLLLQVAATDAAPLGE
Download sequence
Identical sequences Q3KJZ5
205922.Pfl01_0167 gi|77456395|ref|YP_345900.1| WP_011331880.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]