SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_1398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_1398
Domain Number 1 Region: 9-148
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-30
Family cAMP-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_1398
Sequence length 157
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MSEPTLLNNEIRDWLMDCGLFDQLQLADFAAASGYFSISTVAEGEAIFREGDAGSFMCII
HTGQVAVQKTGGDGQVVTMATLRSGRAFGEMAVLDGERRSATCVAASNCQLLNLGKDSLE
KMLNDAPKIAAKIIRALAVSLSKRLRMADGQLAAQQI
Download sequence
Identical sequences A0A0C1WHI3 A0A173J031 A0A2K4HSQ4 J2PRS8 Q3KGG5
205922.Pfl01_1398 WP_007956482.1.15864 WP_007956482.1.21564 WP_007956482.1.22023 WP_007956482.1.2668 WP_007956482.1.30523 WP_007956482.1.32803 WP_007956482.1.38776 WP_007956482.1.46399 WP_007956482.1.47897 WP_007956482.1.51676 WP_007956482.1.53106 WP_007956482.1.54387 WP_007956482.1.54700 WP_007956482.1.55771 WP_007956482.1.58385 WP_007956482.1.58965 WP_007956482.1.62013 WP_007956482.1.64081 WP_007956482.1.72974 WP_007956482.1.84829 WP_007956482.1.85257 WP_007956482.1.91175 WP_007956482.1.91687 WP_007956482.1.91867 WP_007956482.1.96080 WP_007956482.1.98588 WP_007956482.1.9973 gi|77457625|ref|YP_347130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]