SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 205922.Pfl01_2325 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205922.Pfl01_2325
Domain Number 1 Region: 121-375
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.03e-64
Family D-glucarate dehydratase-like 0.00000000316
Further Details:      
 
Domain Number 2 Region: 10-134
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.65e-33
Family Enolase N-terminal domain-like 0.000000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205922.Pfl01_2325
Sequence length 377
Comment (Pseudomonas fluorescens Pf0 1)
Sequence
MDTEMNRILIENLSAIIVDLPTIRPHKLAMHTMQNQTLVILRLRCSDGVEGIGEATTIGG
LAYGYESPESIKANIDAHLAPALIGMDADNINVAMQKLDKIAKGNTFAKSAIESALLDAQ
GKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEAEQMLEARRHRIFKLKIGANPLE
QDLKHVVAIKKALGERASVRVDVNQYWDESQAIRGCRVLGDNGIDLIEQPISRVNRSGQI
RLNQRSLAPIMADESIESVEDAFSLAADGAASVFALKIAKNGGPRAVLRTAQIAEAAGIA
LYGGTMLEGSVGTLASAHAFLTLRQLTWDTELFGPLLLTEDIVTERPQYRDFHLHIPRTP
GLGLTLDEERLARFRRH
Download sequence
Identical sequences Q3KDT8
205922.Pfl01_2325 gi|255961275|ref|YP_348057.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]