SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 206672.BL1459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  206672.BL1459
Domain Number - Region: 37-98
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0478
Family Phage repressors 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 206672.BL1459
Sequence length 108
Comment (Bifidobacterium longum)
Sequence
MSNLDYNLPEPTKAQLEYARYLSRFQAPRERRTLFARTESDIAAAFREETANHSWNADDL
ASQAGIDPRFADALLQRGEAPIEAVFSAADALGIDIAALPLSSLGNTR
Download sequence
Identical sequences A0A083X2Q9 A0A083XS33 A0A0A1GRS2 A0A0A6VK78 A0A0L7AY74 C2GXN6 C5EC95 E5XZ25 Q8G4C9 S2ZXX6
206672.BL1459 NP_696618.1.18194 WP_007052694.1.11999 WP_007052694.1.28172 WP_007052694.1.29295 WP_007052694.1.35419 WP_007052694.1.39608 WP_007052694.1.41489 WP_007052694.1.49187 WP_007052694.1.49397 WP_007052694.1.50944 WP_007052694.1.51653 WP_007052694.1.51739 WP_007052694.1.54925 WP_007052694.1.55246 WP_007052694.1.55576 WP_007052694.1.56191 WP_007052694.1.61280 WP_007052694.1.69620 WP_007052694.1.76144 WP_007052694.1.76203 WP_007052694.1.84493 WP_007052694.1.86174 WP_007052694.1.94251 WP_007052694.1.94713 WP_007052694.1.95296 WP_007052694.1.97601 WP_007052694.1.98972 WP_007052694.1.99722 gi|23466015|ref|NP_696618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]