SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 207559.Dde_0037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  207559.Dde_0037
Domain Number 1 Region: 39-205
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.41e-21
Family Clp protease, ClpP subunit 0.074
Further Details:      
 
Domain Number 2 Region: 375-441
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000111
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 207559.Dde_0037
Sequence length 452
Comment (Desulfovibrio desulfuricans G20)
Sequence
MNTSHALYRKITAICATLCFFAAFHPAMPASGAENAVQKHTVSVVHVTIKAGIGPATADL
LRGAIKQAESGSDMVLVTLDTPGGLVSSMREMVQDILNADVPVGVWVGPSGAHAASAGVF
IVAASSISGMAPQTTMGAAIPVTPDGADTKGDMATKVKNDLSSLVSGLAERRNRNVDWYV
SAVREGKSLPASQAIMNNVVEFMATTPEDFLVQAGSRGVPAGMGTLRFTADDIRIIPYEP
GLRYRFLGWLLDPQVAYLLLLAGVALLFVEFTHAGAILPGVLGALSLLLGLYAMTILPTA
AAGLLLILLGLVLFLLEIKVVSFGLLSLAGVAALFIGSLILFPESEGLRLPMMTIGPTVL
GISAFMGGLVWLAVKAQRSKSAMASDQLAGQQAMVMRWQGRKGTVKLHGTLWNAVTREEQ
PIAKGETVTVTGAKGLTLHVSTHPAPEDAVQE
Download sequence
Identical sequences Q317N8
207559.Dde_0037 gi|78355084|ref|YP_386533.1| WP_011366230.1.27936 WP_011366230.1.39573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]