SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 207559.Dde_2351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  207559.Dde_2351
Domain Number 1 Region: 465-572
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000357
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Weak hits

Sequence:  207559.Dde_2351
Domain Number - Region: 322-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00706
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 207559.Dde_2351
Sequence length 860
Comment (Desulfovibrio desulfuricans G20)
Sequence
MVSNGLGLWLSWRGDLNPAVVQTLQDYGGMHLASERDQALWFFFSADAFLALARLAIWAK
FNTLAVFCQVIPAKLLFGYKRELSVAIDQTLRAQNAIAPQEFEIWVHSRAKDMGTGTPGL
RFESVRTQTGLAAAEWFTMTADPRLPYQSSLGWNVVLKPLGNPVEKAFQAGWREYFTHLD
QLLSRLKCKFIIHDFFVMFPVDNLRQLRTWCKELLQLVARLKEEDPEAYWPCVVAVADRK
GLNINEDLPKKMRLDWDQLVPDFPHMSFRNAYLLGEGFVVHDVRFSIDHSSMDDWCNVSL
SADGDAGAGLLPVEVSNRLVTGNSPHCFYCGLRNHVLTECPSRQLTTLDRGIWREVALLD
FETMNKGFKSIDSMLAEGGLEALSGALRQDGIPGILTRAIFSINSAMQLRMMRVMWLTRG
KDYPAGLDELAPKDESPVWSLLEMFISGDHIAVDKELGQQAVKAPRDFRVRTLNGFVALE
RGDHARALSLWREAEGLSPSPLLQAYHQFLQGRLMESQGRYQNATTLYRQLVRLTPGWTD
AAYRQGVCQVKMGFAEQAVGFLNSLIERDPHFFNRVLLDPELERGHIQLLSALNGPWLEA
ESRAGDESAALQRLRTEIYEWFPEEHDFAKAALERAEKLGALGEVNNYVSFITLSRGRER
LERDLHARVNLETKELKARFRRNMDRLAYIRDEAAWFPFPRVLVDFNKDYNLCAANLNWA
LQTQFGVAETFKKAQKVGETEEERLKGLEGKLRFLRIVRDSTLFMLILGKTFFWLELVGL
LLVLVGLPLSVYYGERAGAEWATGLLVKEKWQIQKGLILILSTAALGFAALRTTLVFDKK
RNKLLEQGKKSSSGAKKKKR
Download sequence
Identical sequences Q30YU8
gi|347359995|ref|YP_388843.3| 207559.Dde_2351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]