SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 208963.PA14_05880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208963.PA14_05880
Domain Number 1 Region: 25-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.67e-26
Family Clp protease, ClpP subunit 0.052
Further Details:      
 
Domain Number 2 Region: 370-436
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000929
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 208963.PA14_05880
Sequence length 443
Comment (Pseudomonas aeruginosa UCBPP-PA14)
Sequence
MRMPCRLALALLLCFAGPACLAASGPVRVLSVDGAIGPASADYLVRGIERAAEDGAQLVV
LELDTPGGLDASMRRIVKAILASQVPVAGFVAPSGARAASAGTYILYACHIAAMAPGTNL
GAATPVRLGTPDKPAEKPPARDAEPMARKQVNDAAAYIRGLAQLRGRNVEWAERAVREAV
SLAAHEAAAQRVIDLQARDLPDLLRQLDGRSLRVGERALTLATAGATVERQAPDWRARLL
AVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLLLGLYALQMLPLNYAGLALI
ALGLAFMVGEAFVASFGVLGIGGIVSFVVGALILIDTEVPGYGIPPGLVVALALLSAALI
VGLLGMALRTRRQAVVSGTAGLVGSLATVAAVDSEQPCAGWVLLQGERWRVLAARPLAVG
QPVWVLARKGLLLEVALADEGGG
Download sequence
Identical sequences A0A0H2ZK87 A0A157U858
gi|116054180|ref|YP_788624.1| 208963.PA14_05880 WP_004365143.1.10248 WP_004365143.1.10575 WP_004365143.1.10895 WP_004365143.1.11318 WP_004365143.1.12150 WP_004365143.1.13085 WP_004365143.1.13718 WP_004365143.1.13743 WP_004365143.1.16751 WP_004365143.1.16811 WP_004365143.1.17108 WP_004365143.1.17177 WP_004365143.1.17223 WP_004365143.1.18156 WP_004365143.1.18440 WP_004365143.1.18508 WP_004365143.1.18907 WP_004365143.1.19199 WP_004365143.1.19640 WP_004365143.1.2012 WP_004365143.1.20825 WP_004365143.1.24413 WP_004365143.1.2530 WP_004365143.1.28757 WP_004365143.1.30615 WP_004365143.1.31563 WP_004365143.1.31655 WP_004365143.1.32359 WP_004365143.1.33047 WP_004365143.1.33438 WP_004365143.1.33833 WP_004365143.1.34556 WP_004365143.1.35442 WP_004365143.1.35968 WP_004365143.1.36064 WP_004365143.1.36267 WP_004365143.1.37571 WP_004365143.1.38023 WP_004365143.1.38816 WP_004365143.1.39765 WP_004365143.1.40442 WP_004365143.1.40984 WP_004365143.1.41110 WP_004365143.1.41429 WP_004365143.1.42316 WP_004365143.1.42499 WP_004365143.1.43286 WP_004365143.1.43756 WP_004365143.1.44725 WP_004365143.1.45604 WP_004365143.1.45700 WP_004365143.1.48472 WP_004365143.1.48851 WP_004365143.1.49108 WP_004365143.1.49806 WP_004365143.1.51957 WP_004365143.1.52500 WP_004365143.1.52850 WP_004365143.1.55387 WP_004365143.1.55813 WP_004365143.1.56626 WP_004365143.1.57369 WP_004365143.1.58200 WP_004365143.1.58360 WP_004365143.1.58510 WP_004365143.1.58800 WP_004365143.1.60084 WP_004365143.1.60472 WP_004365143.1.62703 WP_004365143.1.64544 WP_004365143.1.6461 WP_004365143.1.65312 WP_004365143.1.65457 WP_004365143.1.65632 WP_004365143.1.66155 WP_004365143.1.68172 WP_004365143.1.68499 WP_004365143.1.68979 WP_004365143.1.70537 WP_004365143.1.71249 WP_004365143.1.7163 WP_004365143.1.72920 WP_004365143.1.74281 WP_004365143.1.74326 WP_004365143.1.74685 WP_004365143.1.75431 WP_004365143.1.76077 WP_004365143.1.76141 WP_004365143.1.78118 WP_004365143.1.78288 WP_004365143.1.79754 WP_004365143.1.8038 WP_004365143.1.80683 WP_004365143.1.80785 WP_004365143.1.81470 WP_004365143.1.81856 WP_004365143.1.81874 WP_004365143.1.81927 WP_004365143.1.83440 WP_004365143.1.83460 WP_004365143.1.83503 WP_004365143.1.83540 WP_004365143.1.84558 WP_004365143.1.85150 WP_004365143.1.85638 WP_004365143.1.85920 WP_004365143.1.86665 WP_004365143.1.86796 WP_004365143.1.8785 WP_004365143.1.87888 WP_004365143.1.88540 WP_004365143.1.89480 WP_004365143.1.91392 WP_004365143.1.92630 WP_004365143.1.93568 WP_004365143.1.93889 WP_004365143.1.94333 WP_004365143.1.95782 WP_004365143.1.96058 WP_004365143.1.961 WP_004365143.1.985 WP_004365143.1.98873 WP_004365143.1.99065 WP_004365143.1.99378 WP_004365143.1.99772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]