SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 208964.PA4041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208964.PA4041
Domain Number 1 Region: 122-376
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.53e-44
Family D-glucarate dehydratase-like 0.00000795
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.92e-26
Family Enolase N-terminal domain-like 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 208964.PA4041
Sequence length 389
Comment (Pseudomonas aeruginosa)
Sequence
MRIQEVRERSIPLSRYAGVAAATGGLSTSLVAVLTDIVRDGRRVVGYGHASVGRYAQGGL
IRERFAPRLLGAPADSLASDDGSGIDPLRAWDLMMRDEKPGGHGERCVAVGALDMALWDA
AAKAAGLPLHRFLARRLGLAEDYPQRVPVYAGGGYPYPHDDLGRLEEELRRFVDLGYTHA
KIKIGAAGLDQDRRRIDRALRVLGDASRLAVDAMNRYDAEGAVDAAKALAPLGLWWFEDI
CDPHDFPTQAEVADIYPGPIGAGEALFSLAEARLLDLYGGVRRERDVLVFDPVHCYGLPG
YLAILDHLCARGWPRAAFRPHAGYLFSLHLVAALRLGWAEATPSAFRPFDDFAGALPFSS
GLAGLPQSPGIGFERQATLAGLFRKLLEA
Download sequence
Identical sequences A0A2J9I889 Q9HWY6
208964.PA4041 NP_252730.1.87394 WP_003114914.1.100100 WP_003114914.1.100742 WP_003114914.1.10513 WP_003114914.1.12980 WP_003114914.1.13407 WP_003114914.1.14966 WP_003114914.1.15692 WP_003114914.1.16041 WP_003114914.1.16242 WP_003114914.1.1670 WP_003114914.1.18653 WP_003114914.1.20024 WP_003114914.1.22491 WP_003114914.1.23967 WP_003114914.1.24879 WP_003114914.1.25271 WP_003114914.1.26489 WP_003114914.1.28528 WP_003114914.1.28602 WP_003114914.1.28838 WP_003114914.1.2980 WP_003114914.1.31103 WP_003114914.1.3179 WP_003114914.1.3189 WP_003114914.1.33523 WP_003114914.1.34136 WP_003114914.1.34472 WP_003114914.1.34784 WP_003114914.1.34821 WP_003114914.1.34836 WP_003114914.1.35104 WP_003114914.1.35480 WP_003114914.1.35639 WP_003114914.1.37319 WP_003114914.1.37500 WP_003114914.1.3821 WP_003114914.1.38319 WP_003114914.1.39989 WP_003114914.1.40135 WP_003114914.1.40419 WP_003114914.1.40546 WP_003114914.1.40874 WP_003114914.1.41773 WP_003114914.1.41846 WP_003114914.1.41871 WP_003114914.1.47296 WP_003114914.1.47312 WP_003114914.1.48413 WP_003114914.1.49135 WP_003114914.1.50653 WP_003114914.1.51141 WP_003114914.1.51847 WP_003114914.1.52326 WP_003114914.1.53169 WP_003114914.1.53371 WP_003114914.1.54462 WP_003114914.1.55347 WP_003114914.1.56623 WP_003114914.1.56837 WP_003114914.1.5889 WP_003114914.1.59099 WP_003114914.1.60206 WP_003114914.1.60261 WP_003114914.1.61943 WP_003114914.1.62357 WP_003114914.1.63124 WP_003114914.1.65066 WP_003114914.1.66931 WP_003114914.1.66945 WP_003114914.1.68857 WP_003114914.1.69834 WP_003114914.1.71891 WP_003114914.1.73455 WP_003114914.1.73941 WP_003114914.1.74000 WP_003114914.1.7779 WP_003114914.1.78112 WP_003114914.1.78623 WP_003114914.1.78986 WP_003114914.1.79429 WP_003114914.1.80535 WP_003114914.1.81581 WP_003114914.1.81728 WP_003114914.1.81771 WP_003114914.1.81802 WP_003114914.1.83131 WP_003114914.1.84297 WP_003114914.1.84398 WP_003114914.1.84538 WP_003114914.1.84702 WP_003114914.1.84715 WP_003114914.1.86708 WP_003114914.1.86733 WP_003114914.1.8727 WP_003114914.1.88949 WP_003114914.1.89234 WP_003114914.1.89266 WP_003114914.1.8949 WP_003114914.1.89491 WP_003114914.1.89776 WP_003114914.1.90024 WP_003114914.1.90770 WP_003114914.1.92175 WP_003114914.1.93897 WP_003114914.1.95324 WP_003114914.1.95994 WP_003114914.1.96667 WP_003114914.1.96702 WP_003114914.1.96880 WP_003114914.1.98308 WP_003114914.1.98600 WP_003114914.1.99214 gi|15599236|ref|NP_252730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]