SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 210007.SMU.1247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  210007.SMU.1247
Domain Number 1 Region: 139-430
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.72e-128
Family Enolase 0.00000000043
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.21e-58
Family Enolase N-terminal domain-like 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 210007.SMU.1247
Sequence length 432
Comment (Streptococcus mutans)
Sequence
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYG
GLGTQKAVDNVNNIIAEALIGYDVRDQQAIDKAMIALDGTPNKGKLGANAILGVSIAVAR
AAADFLEIPLYSYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQEFMIVPAGAPTFKEALR
WGAEIFHALKKILKERGLETAVGDEGGFAPKFDGTEDAVETIIKAIETAGYKPGEEVFLG
FDCASSEFYDNGVYDYTKFEGEKGAKRSAAEQIDYIEELVNKYPIITIEDAMDENDWDGW
KALTARLGDRVQLVGDDFFVTNTDYLARGIKEGAANSILIKVNQIGTLTETFEAIEMAKE
AGYTAVVSHRSGETEDSTIADISVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAE
YRGLKSFYNLKK
Download sequence
Identical sequences A0A0E2EJG4 A0A0E2ENK7 B5LBH7 Q8DTS9
gi|290580335|ref|YP_003484727.1| NP_721624.1.8892 WP_002263196.1.101419 WP_002263196.1.11146 WP_002263196.1.11334 WP_002263196.1.11591 WP_002263196.1.12313 WP_002263196.1.12932 WP_002263196.1.15351 WP_002263196.1.15378 WP_002263196.1.15704 WP_002263196.1.15966 WP_002263196.1.16444 WP_002263196.1.1718 WP_002263196.1.17336 WP_002263196.1.17675 WP_002263196.1.18727 WP_002263196.1.18742 WP_002263196.1.18958 WP_002263196.1.2040 WP_002263196.1.20910 WP_002263196.1.2229 WP_002263196.1.23024 WP_002263196.1.24293 WP_002263196.1.2541 WP_002263196.1.26164 WP_002263196.1.27968 WP_002263196.1.28176 WP_002263196.1.28418 WP_002263196.1.29228 WP_002263196.1.29492 WP_002263196.1.301 WP_002263196.1.30473 WP_002263196.1.30759 WP_002263196.1.30947 WP_002263196.1.31808 WP_002263196.1.32163 WP_002263196.1.32790 WP_002263196.1.34420 WP_002263196.1.34969 WP_002263196.1.3499 WP_002263196.1.3516 WP_002263196.1.3629 WP_002263196.1.36850 WP_002263196.1.36939 WP_002263196.1.37774 WP_002263196.1.40143 WP_002263196.1.40570 WP_002263196.1.41490 WP_002263196.1.41875 WP_002263196.1.43025 WP_002263196.1.43640 WP_002263196.1.43675 WP_002263196.1.44799 WP_002263196.1.45183 WP_002263196.1.45235 WP_002263196.1.45508 WP_002263196.1.46710 WP_002263196.1.46900 WP_002263196.1.47778 WP_002263196.1.49832 WP_002263196.1.50032 WP_002263196.1.50052 WP_002263196.1.50471 WP_002263196.1.50881 WP_002263196.1.51119 WP_002263196.1.51230 WP_002263196.1.51366 WP_002263196.1.51387 WP_002263196.1.51717 WP_002263196.1.51808 WP_002263196.1.54626 WP_002263196.1.55052 WP_002263196.1.56050 WP_002263196.1.56170 WP_002263196.1.56945 WP_002263196.1.57092 WP_002263196.1.57272 WP_002263196.1.59541 WP_002263196.1.5956 WP_002263196.1.59872 WP_002263196.1.5991 WP_002263196.1.60757 WP_002263196.1.60865 WP_002263196.1.61642 WP_002263196.1.62115 WP_002263196.1.63822 WP_002263196.1.64300 WP_002263196.1.64336 WP_002263196.1.65140 WP_002263196.1.65660 WP_002263196.1.66026 WP_002263196.1.67144 WP_002263196.1.67232 WP_002263196.1.6903 WP_002263196.1.69244 WP_002263196.1.69362 WP_002263196.1.70045 WP_002263196.1.70318 WP_002263196.1.70601 WP_002263196.1.71645 WP_002263196.1.71809 WP_002263196.1.72550 WP_002263196.1.72844 WP_002263196.1.73818 WP_002263196.1.74195 WP_002263196.1.7464 WP_002263196.1.75183 WP_002263196.1.75315 WP_002263196.1.76683 WP_002263196.1.77182 WP_002263196.1.77215 WP_002263196.1.7770 WP_002263196.1.78804 WP_002263196.1.80579 WP_002263196.1.80841 WP_002263196.1.80886 WP_002263196.1.81687 WP_002263196.1.82630 WP_002263196.1.82913 WP_002263196.1.83363 WP_002263196.1.83426 WP_002263196.1.83737 WP_002263196.1.8393 WP_002263196.1.86023 WP_002263196.1.8622 WP_002263196.1.86495 WP_002263196.1.86849 WP_002263196.1.88284 WP_002263196.1.89520 WP_002263196.1.90023 WP_002263196.1.9086 WP_002263196.1.91353 WP_002263196.1.91450 WP_002263196.1.91503 WP_002263196.1.91936 WP_002263196.1.92946 WP_002263196.1.93729 WP_002263196.1.94193 WP_002263196.1.94501 WP_002263196.1.94637 WP_002263196.1.94726 WP_002263196.1.95315 WP_002263196.1.956 WP_002263196.1.9576 WP_002263196.1.95949 WP_002263196.1.96000 WP_002263196.1.97175 WP_002263196.1.98526 WP_002263196.1.98911 gi|397649885|ref|YP_006490412.1| 210007.SMU.1247 gi|24379669|ref|NP_721624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]