SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 211586.SO_2890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  211586.SO_2890
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.51e-29
Family Sfri0576-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 211586.SO_2890
Sequence length 126
Comment (Shewanella oneidensis)
Sequence
MLTIRPSYADDVLTIVVSGQVTHEDIETLLFPAIEAKLQDHASIRLWYEFSADFIGITVG
ALWDDALLSVFHFSDFSRVVMIADMQILGAMVNTLAFMLPCPVKVFGENERQLAKVWLDE
AKVVEA
Download sequence
Identical sequences Q8ED76
gi|24374419|ref|NP_718462.1| 211586.SO_2890 NP_718462.1.27637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]