SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 212717.CTC00948 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  212717.CTC00948
Domain Number 1 Region: 132-284
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.29e-23
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.018
Further Details:      
 
Domain Number 2 Region: 13-120
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.42e-22
Family DNA-binding N-terminal domain of transcription activators 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 212717.CTC00948
Sequence length 284
Comment (Clostridium tetani E88)
Sequence
MSSKTYMYGGEYMLKIGDFSKLSRISIRMLRHYNDIGLLIPEDIDEFTGYRYYSEVQLPL
ANRINALKDMGFKLSTIEKILKEYGDNEALEKYLLIKYEELNEKSEDINRRLTLLKSTIK
RLRKDEDAMKYNVTLKEMPKRQVASLREIIPSYEMEGILWEEIRKEMDAQNVQFGNPCNT
IAVFHDKGYKESDVDVEIQISVEGNYEDTKKVKFKTVEAIEIASVTFKGGYEQIGEVNEA
IANWIVDNNYEFNGAMFNIYHVSPAMDKNPENWVSEVCYPVKKK
Download sequence
Identical sequences Q896Q0
gi|28210659|ref|NP_781603.1| 212717.CTC00948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]