SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNA02330 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNA02330
Domain Number 1 Region: 225-268
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000107
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 
Domain Number 2 Region: 304-326
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Weak hits

Sequence:  214684.CNA02330
Domain Number - Region: 185-223
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000262
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNA02330
Sequence length 651
Comment (Cryptococcus neoformans var JEC21)
Sequence
MAHYVPTSFKPMRSLVAAAGIQLSPSPSSDHNEGTFETEDGELLLGNIIIDEFPADGDRP
PVKGEHFQPPGLFNTSMMPTIVTTDGKLHVELKTKDDKAAISEKGQGEGLMLPQHVLLET
SSAVQAAEDGGDDGEEGDHSLGGDDFWEGLHFVDDDIIRGSRRYFNPEPEDNLEVEATFL
ATADSRKVCQNCKRPGHQASKCPHIICTTCGAMDEHERRDCPLSKVCYGCGRRGHHKSEC
PDPISRNKRWAGCERCGSREHTDKNCPTLWRIYTYRSDSGRRETIKLKEKAEGWVKEAIG
GDAMEDWCYNCARTGHFGDDCPQRRGSLVRLTAPSAFSREIARRGPFFSAPKSFLPNPTH
SRWEDDDPSAIPYTSAYDSFAGSNAGRRGREKEKQQMMARDTDFNDEDDWFSGDRNRNIG
KGAGTPRNNPRGGRGGKRPWDSEMRGKEWDRDRYDRERASREFFDRDREPPRSRGQAPPR
RRSRSPNRRDGSRDNAVQETAPNSAPPKAVYRPAINIRDRAIDSPSVREGERGAKAGSKA
LVSRALSGQNSSNSTPRGQRSSNSPSALPSLLSRIESPTPSNSTSRSRKGRGKEQERDWE
NEWRRRGNGGGKVANWGKDLDKETEGLSLKKKTKDDISRGSSGQKYYGGYM
Download sequence
Identical sequences Q5KPL9
XP_567235.1.95466 181.m08850 214684.CNA02330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]