SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNA04900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNA04900
Domain Number 1 Region: 130-160
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000331
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNA04900
Sequence length 340
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSALTYARVRYYIDLPSPQSTVECPMDSLGSSKSTETAPVCTADTDIATWLGTMGSLARD
LTAMELTVDKVLCALYLRSLPSRFDTFVTSVLSGTSNLSDSNLKSDVLRAAILNFYTAQK
RGGSTQALPAQGPSVRYPCHICRAPNHWATDCPQENKKTSGQRRHRKPTASVSSISAAES
THCSLNVPLEWILDNGAFESMTGDRSWLQDLHRMANGGSLTANEAGTAVFLNHRGAQIQL
SHVLLAPGLRFNLLSTTGIMTAGVRVSMADGHSDFLYHGESVLRARLGNNSWVLGVCRPP
CPPSSQLISLPAVIDPTSPPAFVRVSVHLRTNNLREQCTI
Download sequence
Identical sequences 214684.CNA04900 181.m08244 XP_566930.1.95466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]