SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNA05540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNA05540
Domain Number - Region: 473-495
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0706
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNA05540
Sequence length 678
Comment (Cryptococcus neoformans var JEC21)
Sequence
MLTSEDLHRLAFRRRADLRAGSSASAACIRQLVSNDELHRPFVNTRDELIGLVYTKRTAR
ALIHRFPEVLFFDCTYKTNLYRMPMLHIVGSTSTGMTYTAGVILMLRETTNWYTQALNSF
FELVGKPDVKVVITDRDPALINALMSVLPKAYRFSCFWHLQENVKSNIRPCFVDEENIVM
AVSNFCKAWVRYCVHAKSDEQLEEGYRKMEELYPGQKYARAISYIRGLDEIKERFVHAYI
NKQLHFGQTGNSRLEGQHATLKKSIDTKYGDLLLVIGSLSTYFDQQWLKILKRIELERTR
CATHIPSTFVRLKGSISRAAMKLLAEQLTLAKRYLGDYDEGVDDFEESHPCSGSFTKSHG
LPCAHRLISFVRERRHLEKDHIHPHWRLGSAASLKRYLDHINRLVGTPDTSVIRLDDVFD
FGEDQELILDPPILSTKRGRKAPNPPVLQEDRMSAPSGRYLTQSERIMGAGLTQRKKGRC
KHCQSSTHYTKDCARVQASRRVDKNQEAENAGEDRRVLVPDSDDEEGNEEDLVEVPNEPN
LRPKKHSRSQYPAPSQIYPSHAVQMQHLPPEPSVPQLPPSSQFYPPLSQYYPPAPQHYPT
SKYHVPPTQYIPYNQVLFHNHSEAPTPYHYPSVSGYNNLQSPQIYQYNLENNVGKDASIR
SQEDSIIMQRGRDRHSWE
Download sequence
Identical sequences 214684.CNA05540 XP_566879.1.95466 181.m08309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]