SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNB00460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNB00460
Domain Number - Region: 261-295
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00481
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 400-442
Classification Level Classification E-value
Superfamily Photosystem II antenna protein-like 0.0262
Family Photosystem II antenna protein-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNB00460
Sequence length 446
Comment (Cryptococcus neoformans var JEC21)
Sequence
MPDEQYSTSISSIPKLIGNRNFIAWRRAILAYLSERGARRVLEGFEKEPYRLEGESHRPP
GEYAGANPPSGFDASGEKELNEKQLIKWDEWQSRESKARAAIILSVSQAIAGEIDGLWSA
HDMYKLICSLFSVGNDAQKGDISRRLDTLTLRENATSQEMQAHFDAFFALLSEGKSIGLD
VADWDRREKFLLSLPRDLQTILRTSLRGRSTQTWAELCSLFNEEIDIRSRQDLRDAQINA
AVKMEKGGRRQQDNGEKGGKGGKKHKKKKGGEVKKCGWCGIKGHEEKECRKKAAGDPSQA
EIRQAIQHIRQQKSNDVHLWATITLVNDTANASPYFMLDTRASHHITNIRSALVNLRPAE
VINFGLAGTMHQFSSYEEGDLRVPVEDGIILIKGIRYSPGANHSILSASCLRAANWHIEL
EKDYLSLGPHKFTLSWDNRHNFPATD
Download sequence
Identical sequences F5HAX2
XP_569055.1.95466 XP_776997.1.65578 sgtc|cn02529 214684.CNB00460 186.m04087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]