SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNB05750 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNB05750
Domain Number 1 Region: 142-389
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.65e-57
Family D-glucarate dehydratase-like 0.00036
Further Details:      
 
Domain Number 2 Region: 39-157
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.83e-29
Family Enolase N-terminal domain-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNB05750
Sequence length 423
Comment (Cryptococcus neoformans var JEC21)
Sequence
MPKQWPTIVKLETFIPSAHGSGGDYHRQGGDHWIVQGNISCPMHKYEEYKVSRTSWGIGV
LGSIFVKVHASDGTVGYATGFGGPPACWLIEEHFKRFIVGQDPRDTNKMWDQMFRASMFY
GRKGLPLAAISVVDLAIWDLLGKIRGEPIYKMIGGRTKKDIPLYLTGPRPEVAKKLGFWG
SKVALPHGPPDGHEGIRKNVEYLKACKEAVGPDYPVQVDCYMSLDVPYTIALVKACEKAG
VEINWWEEVLHPDDFDGHIKLKEALPYVKFTTGEHEYSKYGFRKLIENRAVDIIQPDVMW
LGGLTELIKVAAMAAAYDIPVVPHGSGPYSFQAIMSFPNSDFCEYIANSPDGKSIEPSFG
NLFLNEVLPRNGRVDLTDEPGFGLELNPSAELVPYKSFFTPSKSLGAAGEVEDDGKAKVN
GKH
Download sequence
Identical sequences F5HDR2 Q5KLC6
sgtc|cn02004 214684.CNB05750 XP_569316.1.95466 XP_777430.1.65578 NYSGXRC-9265k 186.m04019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]