SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNC00160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNC00160
Domain Number 1 Region: 144-429
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.59e-123
Family Enolase 0.00000000849
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.08e-55
Family Enolase N-terminal domain-like 0.00000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNC00160
Sequence length 444
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSVVTKVHARQIFDSRGNPTVEVDLYTEKGLFRAEVPSGASTGAHEAVELRDKGSDYMGK
GVLKAVENVNKVIAPALIDSKLPVTSQKEIDDLLIKLDGTENKGKLGANAILGVSMAVSE
AAAADKGVPLYGYLAQLAGVSEPYVLPVPAFNVINGGSHAGNALAFQEFMLLPTGASSFT
EAMKMGSETYHTLKKVITKKYGIDAANVGDEGGFAPNVSGAEESLDLLTEAIKQAGYTGK
VQIGLDVASSEFFKEGKYDLDFKNPNSDSSKWLSGKELADLYHGYCEKYDICSIEDPFHE
DDFDAWAAYNQTAKIQIVGDDLLVTNPRRIKMAIEKKACNALLLKINQIGTISESIQAVQ
LAQSNGWGVMTSHRSGETESTYIADLAVALRTGEIKTGAPCRSERMAKYNQLLRIEEQLE
GKSIFAGGKGLSKGTTAPELHSSK
Download sequence
Identical sequences Q5KLA7
179.m00017 XP_569379.1.95466 214684.CNC00160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]