SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNC03270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNC03270
Domain Number - Region: 645-678
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0102
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNC03270
Sequence length 1558
Comment (Cryptococcus neoformans var JEC21)
Sequence
MPQVTVHRAHSPIVWHGKLKWVARLAPRLQLDASPQQLRIAHVRDGGREVDIWDDYDFDA
FKSRAAAQSAPLVVKVYPPGASSEPGASPATAAPARKPRKKAVPSDDQPAPGTPPSTKKD
KGKSKASPQSQNLAAPVLQPQQPSTPTAAPKSKKRKRDSTSSAAEPLPTRALPVQPTPTG
PGRQSTSPQQPKKRRKRGAKSDAALAPAPPPANPSAPAIASPSRPFTFSLPLQGSAAFIN
RYKPAKPSPLGRIDGPPVLAGETASTSSSPAAKETLQPLTESGKKSRKPRKRKEKKEEGV
GGVPASPAASSVAPSPAPSSSKKQKSRPSVTEEIMRKQREKMAAEEAKKQAENADKANAK
GKDKEKATDKPTAMPAASTSIPLTPSKESTTQPSTPELSTQSPLTKTKKEKSPKTPKVNR
ASEIMRMFREKQAAEAAAKAAEQSIPPVVQTVQPEQPSVSSAQPSTEHLSSTPATPASAL
ESKKPSSAKPKAAPRPSITLEIMRKQREKMAAAETQAAENVEQENAGEAMDVDQPREKAH
IPLVEQSKQGQAEQNTLQLEPQSEIQTESGPVAPPLVSHGFATVPQTPTQSSVQPSNTSS
TTKKTKSGRPSITSEIMRKQREAMAQQAEKEKEQEEQIATRDDGDKEASKPKQPQCLICH
GSSHPQKDCPVVKAGVPRLQQVLLERKEEDESPEAAVAAIEMWIDRLGRVTSALMGTPVT
KGKGRPSSAGLTTQAKQTPSQAASAPAVETESSASESSKSPSPTLPKAASPVPTFPPIYH
KALSRKAGSTSGLSVSDAVIETGSSGSSASESSEDEGGSVGSGSGYGSESETESESSASI
QGQNAMSRSGSTSTSSSPPPSSSSPSPPPPDLSKLDPQAALRHFLTAPLSQKQRRAARDS
AAHMQVVDTQDVEIEEASEVESDEDGTNASFARIRMDDEESLVGEFEDDEKEEDEVEDVE
EEPRDEQPPALPQVQQSESDDEMQLDVEGSQPVLEQESALQPRAGQEEEEIRIDVTNTEA
EPMDVDQRQTPLKTTQSPPESSPLSFHEGSRQSFNDLAALASPSTQHRELPGDAAVREAI
AEDEAPVRDAMRQDDDVHPKQRIPNGVQEPVLTQQLMSPPSSVAEREDEIEPLPATQLVQ
RFEDEEGQGEATPIAKSKAPVRRSTRQPSRQPSVARDDIPSPPRRRLRSASREPALVPEP
PRTRMTRSSSQQRVVPPSPHVPIRRSTRRTVSSQSDVSQLSSSQLEPSSPVQLHATLTPA
TLRRSSRRQTTPLRSSQVDELDPSSPPPASQQPIEESPLFIPETQLQHSQPQSSQSQSLN
SQRFWRISGEEENPLFMSQGSQIPQTQAYNLYPNIDSSSDVGETPRGAKIGIEGSSPSND
KQGEGKRANYLSVSSPILEEDEEEQNALVDTEKHEQTSESGVDEHDDQSVDASEASSDDE
GSSISIPIPRSQPIYPSLPRSSLSFSQPVAASQPSTGFPTLSSLPREALRRMKSTFGFSS
SQPETSKEKTSRHMNGAGDESESETSGDSSDEEPASLRGRFAGTRARKVKSQGAVKGW
Download sequence
Identical sequences 179.m00291 XP_569652.1.95466 214684.CNC03270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]