SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CND02880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CND02880
Domain Number 1 Region: 246-365
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000333
Further Details:      
 
Domain Number 2 Region: 360-411
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000942
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CND02880
Sequence length 546
Comment (Cryptococcus neoformans var JEC21)
Sequence
MWRPAAKTTGTNDVPLANKRRFGLPEEGPPSNSPSYAPRPAADIQYFNGRQERERDARDD
RERPRDDYDRRRDDYVRDDRDRRYDDYPRDGHSDRRDERSKWDEGDRREAPRGRERSRDR
GDSNEDGPRKRRSRWGDASAKVNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLRTGD
VVPPEGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQH
KRGSRPQDKVYIPVKEFPEINFFGLLVGPRGNSLKKMERESGAKISIRGKGSVKEGKGRA
GNFPQDEEDELHCLITADDESKVKTCVALINKVIETAASTPEGENDHKRNQLRELASLNG
TLRDDENQLCQNCGEKGHRRWECPQQRVYSANVICRICGGAGHMARDCRGRGDPSLTQNK
QTAFDSEYTALMAELGEGGGSTPGSAPAAAIGAPGAIPPQSRVPPWRLPENWQTNSGGFR
GPPNFQAQGYQQAAPGAAAYGQQAYPGYAGYQTGAVSGYGSPATGGADAYAAYYASMGQQ
APAAAV
Download sequence
Identical sequences P0CO44 P0CO45
sgtc|cn04354 163.m02728 214684.CND02880 XP_570209.1.95466 XP_775941.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]