SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CND04260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CND04260
Domain Number 1 Region: 137-200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000112
Family Tandem AAA-ATPase domain 0.012
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000133
Family Tandem AAA-ATPase domain 0.033
Further Details:      
 
Weak hits

Sequence:  214684.CND04260
Domain Number - Region: 920-941
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0785
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CND04260
Sequence length 1112
Comment (Cryptococcus neoformans var JEC21)
Sequence
MASTARAKSVRNILMELRKVCQHPYLSAPELEIFDLPLEEQHRQLLNASGKLQFLKLLLP
KLIARGHRILLFSQISYMAKMLSTCALTGIPSKHKGKSIWTNSMRLTQIIIYFFLQQELG
AWGSIWPPQTQSFYTTPISILIRTSRAYRYGQEKRVLVFKLMIKGSVEETIINKGKRKMV
LDHLVVQQMGKETEENDFEDLFLKGVEGMYSGQGGINIPDINYNSKNVDELIDRVEADAE
AEAKAMAERERQDKNGVVKQMKSKQGVPFQFSRIWEADKNELIHDEVQDTVKDEEEEEDV
DWEQLMVAVQAERQLRLQKEMEESRIRRKLKSKEGVYKIDDDFEVDEKKRRKNKGKGKGV
ELSSSDAEYMDGGLSDNGSATDIPDIDLETLKDDLSIDPIVAKSSGGVKRKRSKKILDNV
FNQSTAPHVCPRSSLSHVSTSETPPGSLTTYPAQPGLSLIEPRQNNTAQYSSLSKTGLSG
SMLSANAPEEANDTFSSSKKRNPVDFAQARQTHPPIHSVRPPIEIIAAQNIVQWLFLIIR
ELAWGHHIGHWATLGVREIPAEKRKRLYCIIAADVDGYLRRFRQTPYFLEREQREAVERL
LDSGWPIIPDISALIAVPEKAAVLIDPPFPVSGSGHRESTYASMPPAPPKYVSETSEILR
GATAPEISENDGNTGDAAKTSSNSVTSQGTVSMPPAPPKYVPEAQAILPDATPPETPENN
ENTGGAAKSLLSYETSRDTVSLPDIRGPGAAVLPSSFKEKEDIQNRSDTTSAGGHSIPLA
PQILEQTLHSPVQMPTLVASTPSLSTEIAPVEISQSAHISNGSPSVSRQPGHVTPTHSTG
SSLPELNLQTNGVNDIHKSSEAASASEPAPLAHTSEPALIQSSLKIPSGLPIQLSSSQAV
KGTLPSSSRQSSEIIVADSSGEPGRCEYCLEDGHRLQDCQRMYSVEILEKAFLAIKQSNL
SEGQKRRDLETLDRLKSFMIKAGKLQKDYHFPESSFVAVMSNRSPSSNACHSSVPEPGAQ
GQLTIDKDTRNEGKRDISASERPLRACIQATGDRKSLKRKIRKLKEKIDGLTKAPGEPQT
DKQQMERIMLRKMQSSLFDCYKKWPKERPSDL
Download sequence
Identical sequences XP_570129.1.95466 163.m06484 214684.CND04260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]