SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNE02090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNE02090
Domain Number 1 Region: 151-197
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000000254
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 2 Region: 27-67
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000000814
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 3 Region: 71-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000333
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 
Domain Number 4 Region: 6-25
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000349
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNE02090
Sequence length 204
Comment (Cryptococcus neoformans var JEC21)
Sequence
MFGAPRGSSCFKCGQQGHVAAACPAEAPTCYNCGLSGHLSRECPQPKNKACYTCGQEGHL
SSACPQGSGAGGFGGASGGGECYRCGKPGHIARMCPESGDAAAGGFGGAGGYGGFGGGAG
FGNKSCYTCGGVGHISRECPSGASRGFGGGGGGFGGPRKCYNCGQDGHISRECPQEQGKT
CYSCGQPGHIASACPGAGAEAPAA
Download sequence
Identical sequences F5HFD1 Q5KGW6
sgtc|cn05213 167.m03356 XP_570872.1.95466 XP_775494.1.65578 214684.CNE02090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]