SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNF01810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNF01810
Domain Number 1 Region: 266-293
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000349
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNF01810
Sequence length 1127
Comment (Cryptococcus neoformans var JEC21)
Sequence
MGVPALFRWLSKKYPKIVERVKEDTPKKIRGPDGEIVEEPIRYENPNPNGFEVDNLYLDM
NGIVHPCTHPEGRPAPETEEEMMVEIFKYTERVVNMCRPRKVLMMAIDGVAPRAKMNQQR
SRRFRAAQEAADKEEERREAIKLFEAMGHAVSEETANHKSWDTNAITPGTPFMDLLSISL
KYWVSHKLTTDPGWKDLKIILSDSSVPGEGEHKIMDWIRRQRSYPTWDANTSHVIYGLDA
DLIMLSLATHEPHFRVLREDVFAQSSKGPHACKNCGKVGHIAANCKSDKKFKDPNVAEVA
KTEDPKPFIFLDVACLREYLAVELVVPGMPFPFDLELAIDDWIFMIFFVGNDFLPHLPSL
EIREGAIDVLLKIWRAELPRMGGYLTNHGKVNLDRAQVILEGLAKSEDEIFQKRKDDEER
QEHSQKRRRIEEHKRQDEDKAREEDRNTLTLNGTEYVAVDNPAATARGGPLHPSLPSRPA
FDLVPKEDAVKQPEDQDQKAKKAMAGSNSDIVKNRKAIRMANMSAAQALKAELEGGNDVN
VDDKKAIAQEGKEEDEAVVTVERTEDEEKEQLTKEEARGTLEEQGEKEGVDEEVVPPAIQ
TDEDEGEAPVGDATVAENDESTTPEDDEDPTHVPRKRKRGDSDGDEDSNEEDDDDDDDDA
PPNPEADQPIPKKKLKVNADGTVDYEDDVKLWEPGYRERYYEKKFGVKLSEREFIDKVTK
SYMEGLCWVLEYYYQGVPAWDWFYPYHYAPFAQDFRDVGSMDIKFETSIPFKPFAQLLGV
FPAASRIHLPEPLQTLMIDEDSPILDFYPPDFEIDMNGKKMAWQGVALLPFIDQNRLLTA
LKSKEELLSDDEKRRNSWGDNVMFIANENPLYDLFCDKLYGLRAKDPIPIDTKASYGITG
SVLPDPNCVPASTFDTPIPSISECPDLNPNDSISVRYYFPRQAHPHRSILLRGYKPEPAR
LTESDKDWVRRGGQGGRRGHRHNGGGNGNVTGGPGMARGRYESGPPRTNGYQPPPPRSNY
GGSSGYGYGAPAPLPSRPPVSSYGGGAGGYGYSNPYAAAPNPYAGGYGAPAPYAAGGYGQ
RPYVPPLPPPNPYSAPPPAYGRPPGGGYGYGAPPPRGGGYNPYPSRR
Download sequence
Identical sequences P0CL88
XP_571517.1.95466 214684.CNF01810 180.m00337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]