SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNF02790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNF02790
Domain Number - Region: 690-712
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0994
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 214684.CNF02790
Sequence length 895
Comment (Cryptococcus neoformans var JEC21)
Sequence
MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFDEGNLHAMEGSDSSEVS
NIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDECKGAVQAYAASQGFAAVI
RRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGDSFKDVRIRTIQTVKNGCPFAAVAWE
MAEAEVKEHGGDKCWTWKVVNASHNHPPVANIGIALLRRASRTPEAKELINTLIDSRTPF
PSIISTMSQRFPTVMLTSEDLHRLAFRRRADLRAGSSASAACIRQLVSNDELHRPFVNTR
DELIGLVYTKRTARALIHRFPEVLFFDCTYKTNLYRMPMLHIVGSTSTGMTYTAGVILML
RETTNWYTQALNSFFELVGKPDVKVVITDRDPALINALMSVLPKAYRFSCFWHLQENVKS
NIRPCFVDEENIVMAVSNFCKAWVRYCVHAKSDEQLEEGYRKMEELYPGQKYARAISYIR
GLDEIKERFVHAYINKQLHFGQTGNSRLEGQHATLKKSIDTKYGDLLLLKGSISRAAMKL
LAEQLTLAKRYLGDYDEGVDDFEESHPCSGSFTKSHGLPCAHRLISFVRERRHLEKDHIH
PHWRLGSAASLKRYLDHINRLVGTPDTSVIRLDDVFDFGEDQELILDPPILSTKRGRKAP
NPPVLQEDRMSAPSGRYLTQSERIMGAGLTQRKKGRCKHCQSSTHYTKDCARVQASRRVD
KNQEAENAGEDRRVLVPDSDDEEGNEEDLVEVPNEPNLRPKKHSRSQYPAPSQIYPSHAV
QMQHLPPEPSVPQLPPSSQFYPPLSQYYPPAPQHYPTSKYHVPPTQYIPYNQVLFHNHSE
APTPYHYPSVSGYNNLQSPQIYQYNLENNVGKDASIRSQEDSIIMQRGRDRHSWE
Download sequence
Identical sequences 214684.CNF02790 XP_571583.1.95466 180.m00376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]