SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNF03280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CNF03280
Domain Number - Region: 304-329
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000691
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CNF03280
Sequence length 426
Comment (Cryptococcus neoformans var JEC21)
Sequence
MPPKRQTPKDTPLPEEVNSLPVDGDLNSQIAAAILYLSKLVGQQNSSAAAQGNYAPRGIS
IPEASDIPTFTGPIRDVPAVILHTDRLYKLLRTYSLFSPGNDDVREENRRVTILELANNS
IECKALQAWVRTTGRMMEEDGESGWEECIVAFKDAAMPLEWAQKEFRSLFRLQFNQVSDW
PTFDQQAIQHRHNLMGTELYPSDTFMANLYRAACPEILFLRLMTKPEFKNGSLSEVCTQL
QLEVRKYLEEKKEQFTPTRAKAQNSATPQTQPHLAHPVSHYYQAQNPLPYYLSPAGKHIR
KLFAKENRCNDCRKVGHNFKTCPSRRPSMRSNPHPVDNHEDLIQELTSQLDDYLKLETFL
DLDETSIQVSAAADGRTATAPPHPLRFLLMLSSMATGSSSIIIIENYLCWRRSLCIARNR
DWLGDD
Download sequence
Identical sequences 180.m00148 XP_571401.1.95466 214684.CNF03280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]