SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CNI00640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNI00640
Domain Number 1 Region: 116-419
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00011
Further Details:      
 
Weak hits

Sequence:  214684.CNI00640
Domain Number - Region: 844-926
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000253
Family Ubiquitin-related 0.017
Further Details:      
 
Domain Number - Region: 1151-1174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00586
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNI00640
Sequence length 1209
Comment (Cryptococcus neoformans var JEC21)
Sequence
MVKALPKPCQDWDWVGTEVRTPGQITLEHRRRAAGLVTSVVCPRDLTHLGRETTKDDSEV
KGNGKGTGEKKGTGCRAKNCKSNYMCYNNLGTEKLLEPDAKAEFVISNLGDVPQERNGPA
GLRNLGATCYANAFLQLWFHNVPFRNAVYACVTTETTPLYQLALIFAKLEYGEKNVVDPM
GLIDALRLNMGDQQDAAEFSKLFMSLIASEFSKHSDPKLKTLVKDQFEGTMQYITQCECG
YESISETTFLEIELSLKDNTTLQSRLDEFTCPEILDGDNKYSCPSCLSKRRATRRQLPVT
LPPVIHFSLLRFVFDLKSMSRKKSKASIKYPKEAVLGNSVYELKGIISHQGTSAYHGHFV
CETYDESNDTWYICNDELVQPKPVRPHKKIKLEKPGDDKGKLESSKDAYMLVYKRRDGHV
SPQFPPAIVMEKVKEENRGLREELNKVGVRKEVLEDEWEHLKGAKVDTDYIVPRDALAKW
IQSPSFQDLYKPFDYSSILCAHSQVDPLKSSDIRTISALAHDKLLLYTSLPEIDVCLICV
AEGFVARSSITEQQSALEAFDELNAKAELEEGGEEERWCLPKTWLIHWRTGKLPPQTLPT
HSSYTLLCPHNAPLPSSSAPPVTFITSSALSLLHSIFGSFPSFQPGTPPCPECSFEADQN
AESLAQWKTDVKLDKSIKRHLDPRPPAFGLDYYVLPKEFIEKWEVYMKTPAGEKPELDMG
LGRGRCEHGLLDWDPQMEKQRVISEIGWEMLCQKYGEKEPIKVQFGANPPEGKKVNIASF
TPAVCEPCRIIRLSSYDELEIPIVFAPGPPTSYSTPASTGNTSGSKSGSGSSRNTSRTLR
SRLKTLYIQATRQSTIKDLKVSILSQTGITPLLQKIYYKRRTQPQEQEECSGKGNEEEKE
LDNDLTIGKLGYLKGEELILVEVKEEGNLDDDDDTVDGGNGGKGKNGKNEGFGGTALLAR
IACPDCTYENDGAAECCEMCMRDMYDSIRTCSLYTPGSDYAQEENRRVTILDLASNSIEC
SALQAWVGTTGGMTEEDGESGWEEWIVAFKDAAMSLEWTMKEFRSLYRLQFNNLVYFQSQ
ATQHRRHLMGTDLYPSDKNMADFYRTLEVSKYLEAKKEQPAPTRAKAHNPVTPQTQPTPG
SPSGKHIREIFTNKNRCNDCSQVGHNYKTCPKRLYSPGIIRPIKIVQILVTHLQRHHPFT
STSLSASSF
Download sequence
Identical sequences 214684.CNI00640 162.m02970 XP_572952.1.95466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]