SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216389.DehaBAV1_0067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216389.DehaBAV1_0067
Domain Number - Region: 21-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00157
Family Probable transcriptional regulator VC1968, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216389.DehaBAV1_0067
Sequence length 87
Comment (Dehalococcoides BAV1)
Sequence
MEEQKIIVPAKIPGLLEALKNEDAFPDNLRYIMQTHGIGATAISRIYGISRMQVYRYLKG
EDLPREPAIYMSVNEWADYLRKSIKAS
Download sequence
Identical sequences A0A1S7AUS2
216389.DehaBAV1_0067 gi|147668719|ref|YP_001213537.1| 2013891099 WP_011928592.1.45256 WP_011928592.1.55841 WP_011928592.1.66924 WP_011928592.1.84634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]